PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G192900.1.p
Common NameGLYMA_07G192900, LOC100797132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 363aa    MW: 40535.1 Da    PI: 7.7372
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G192900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.51.3e-53151421128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelvv+yLk+k+++ +l++  +i++vd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk
  Glyma.07G192900.1.p  15 LPPGFRFHPTDEELVVHYLKRKAASAPLPV-AIIADVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDK 103
                          79****************************.88***************8888999*********************************** PP

                  NAM  91 evlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                          ++l++ ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  Glyma.07G192900.1.p 104 PILTTyGHHKVGVKKALVFYGGKPPKGVKTNWIMHEYRL 142
                          ***9988899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-6410178IPR003441NAC domain
PROSITE profilePS5100561.54715178IPR003441NAC domain
PfamPF023652.8E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MDSRDSSSGS QHPHLPPGFR FHPTDEELVV HYLKRKAASA PLPVAIIADV DLYKFDPWEL  60
PSKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPILTTYG HHKVGVKKAL  120
VFYGGKPPKG VKTNWIMHEY RLVDDSFNSS SKPPPLVPHN KKNSLRLDDW VLCRIYKKSN  180
NTTLPRPPMM EHEEELSMDN MLPTMSTLSM ANNKMQNPKP PSRSTSYGPL GLENDDNFFE  240
GVLAVDQSMQ NGSDSHIFSP NSKGDNNNNN NNNASNFPIK RALITSQLWN ETGSPGSSSS  300
CKRFHGDLNC GCSNAEDNND SFISLLSQFP QNATFQPNAI HGSVEDDGAP RQQFHLHGIN  360
WN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-741518217169NAC domain-containing protein 19
4dul_A1e-741518217169NAC domain-containing protein 19
1ut7_B1e-741518217169NO APICAL MERISTEM PROTEIN
1ut7_A1e-741518217169NO APICAL MERISTEM PROTEIN
1ut4_B1e-741518217169NO APICAL MERISTEM PROTEIN
1ut4_A1e-741518217169NO APICAL MERISTEM PROTEIN
3swp_D1e-741518220172NAC domain-containing protein 19
3swp_C1e-741518220172NAC domain-containing protein 19
3swp_B1e-741518220172NAC domain-containing protein 19
3swp_A1e-741518220172NAC domain-containing protein 19
3swm_D1e-741518220172NAC domain-containing protein 19
3swm_C1e-741518220172NAC domain-containing protein 19
3swm_B1e-741518220172NAC domain-containing protein 19
3swm_A1e-741518220172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-106AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003528438.10.0PREDICTED: NAC transcription factor 25-like
SwissprotQ8GY421e-106NAC25_ARATH; NAC transcription factor 25
TrEMBLA0A0B2PHV80.0A0A0B2PHV8_GLYSO; NAC domain-containing protein 18
TrEMBLI1KLG20.0I1KLG2_SOYBN; Uncharacterized protein
STRINGGLYMA07G31220.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-103NAC domain containing protein 25